PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Rsa1.0_00640.1_g00007.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Raphanus
Family MYB
Protein Properties Length: 326aa    MW: 36608.9 Da    PI: 7.0704
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Rsa1.0_00640.1_g00007.1genomeRGDView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding61.22.2e-191461148
                             TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
          Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                             rg WT+eEd +l+ +++q+G+++W++I++  g+ R++k+c++rw +yl
  Rsa1.0_00640.1_g00007.1 14 RGQWTPEEDNKLASYIAQHGTRNWRLIPKNAGLQRCGKSCRLRWTNYL 61
                             89********************************************97 PP

2Myb_DNA-binding44.53.7e-1468110246
                              SSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
          Myb_DNA-binding   2 grWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                              g ++  E+ ++v+ +  lG++ W++Ia+ ++ gRt++++k++w++
  Rsa1.0_00640.1_g00007.1  68 GQFSDAEEHIIVKFHSVLGNR-WSLIAAQLP-GRTDNDVKNYWNT 110
                              7899*****************.*********.***********97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.602.8E-25564IPR009057Homeodomain-like
PROSITE profilePS5129426.27965IPR017930Myb domain
SuperFamilySSF466898.24E-2911108IPR009057Homeodomain-like
SMARTSM007173.2E-141363IPR001005SANT/Myb domain
PfamPF002495.3E-181461IPR001005SANT/Myb domain
CDDcd001677.75E-121761No hitNo description
Gene3DG3DSA:1.10.10.602.0E-2365116IPR009057Homeodomain-like
SMARTSM007179.9E-1266114IPR001005SANT/Myb domain
PROSITE profilePS5129419.60166116IPR017930Myb domain
PfamPF002492.0E-1268110IPR001005SANT/Myb domain
CDDcd001672.82E-870112No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 326 aa     Download sequence    Send to blast
MGRIPCCEKD NVKRGQWTPE EDNKLASYIA QHGTRNWRLI PKNAGLQRCG KSCRLRWTNY  60
LRPDLKHGQF SDAEEHIIVK FHSVLGNRWS LIAAQLPGRT DNDVKNYWNT KLKKKLSGMG  120
IDPVTHKPFS HLMAEITTTL NPPQVSHLAE AALGCFKDEM LHLLTKKRVD LNQINFSSPN  180
PNHNNPNNFN QTVDNEAGKM KLDGLENGNG IMKLWDMGNG FSYGSSSSSF GNDERNEGSA  240
SPAVAAWRGH GGIRTSVAET AAAEEEERRK LKGEVMDQEE IGSEGGRGDG TMMMRKHHDQ  300
HQQHAFSVDD NDLWDLQADD LINHMV
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A3e-28141167108B-MYB
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAY5196390.0AY519639.1 Arabidopsis thaliana MYB transcription factor (At5g56110) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009120123.10.0PREDICTED: protein ODORANT1
SwissprotQ9XHV00.0MYB80_ARATH; Transcription factor MYB80
TrEMBLM4CF650.0M4CF65_BRARP; Uncharacterized protein
STRINGBra002847.1-P0.0(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM100052635
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G56110.11e-178myb domain protein 103